PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca29398.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 357aa    MW: 39901.7 Da    PI: 8.1446
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca29398.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.83.1e-51121361129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtd+elv++yL  k ++++ +l   + evd++k+ePwdLp+++  + kewyf+s+rd+kyatg r+nrat sgyWkatgkd++v++ +g+ 
  Dca29398.1  12 LPPGFRFHPTDDELVCDYLLLKWNASHSPL---LIEVDLNKCEPWDLPERACIGGKEWYFYSQRDRKYATGLRTNRATVSGYWKATGKDRAVVR-RGNM 106
                 79***********************99888...779************8777899**************************************9.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                 vg++ktLvfy+grapkg+kt+Wvmhe+rle
  Dca29398.1 107 VGMRKTLVFYQGRAPKGHKTQWVMHEFRLE 136
                 ***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-582161IPR003441NAC domain
PROSITE profilePS5100554.83112161IPR003441NAC domain
PfamPF023656.2E-2613135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MMSSLSMVEA KLPPGFRFHP TDDELVCDYL LLKWNASHSP LLIEVDLNKC EPWDLPERAC  60
IGGKEWYFYS QRDRKYATGL RTNRATVSGY WKATGKDRAV VRRGNMVGMR KTLVFYQGRA  120
PKGHKTQWVM HEFRLEPPFV PNNLIPSPSK EDWVLCRVFF KSKYGPARSS SGTENHERNN  180
NNNNKMIDEV TGSSSVVAMD NYIRFDDTTT TQANANAYQQ VPCFSMFSDN QINHNHNRNH  240
NHNNNNNNPT TSTSMVFHHN NIMMMMMADD NNNNNNNING LGLGPNGNSK GSPNPGPGPG  300
PGPIVACDKK VLQAVLNELT KMEGNAINGS PSIGEAGSSE SYLSEVGLQQ PSLWSPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-51815911166Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666181.11e-122PREDICTED: NAC domain-containing protein 21/22-like isoform X2
TrEMBLA0A0J8B8I01e-122A0A0J8B8I0_BETVU; Uncharacterized protein
STRINGGLYMA15G40510.11e-119(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-92NAC domain containing protein 1